PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g068300.1
Common NameMTR_4g068300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family B3
Protein Properties Length: 274aa    MW: 31107.9 Da    PI: 10.0097
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g068300.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B337.64e-1219971193
                     HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
               B3 11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93
                     ++ + l +p + +++ g++  +++ ++l  +sg++Wev +   kk++ ++l+ GW++F  +n++   + +vF++dg+++f   
  Medtr4g068300.1 19 FNINSLKVPPEIVTDLGEELWKNTFMILVGSSGEKWEVSI--LKKGNDIYLQIGWQKFLIDNKVMLEELLVFTYDGENKF--Q 97
                     5567788999999888777778889999************..*********************************98777..4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.5E-175104IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.44E-165105IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.7019104IPR003340B3 DNA binding domain
CDDcd100171.68E-8994No hitNo description
SMARTSM010199.7E-711104IPR003340B3 DNA binding domain
PfamPF023624.4E-101997IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MDYDHQDKPS FFAIIKEGFN INSLKVPPEI VTDLGEELWK NTFMILVGSS GEKWEVSILK  60
KGNDIYLQIG WQKFLIDNKV MLEELLVFTY DGENKFQGQI FGKNGLERPC FKNVPEQEEV  120
QEEEEEVTAA PPFTVAKRKR GRPRKVPSPE SECFKKEKAE VPAKIAVKRN DCRARKSPAG  180
ERVCFRKKEE VAATIMSMGK RRKNRQRVSV KKEEAKAAAT MAAAINKGRT RENPAGERVC  240
VKKEDAKAEE TIVAERKKGR PRKYSAPVVI YVN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185202RKKEEVAATIMSMGKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1378250.0AC137825.26 Medicago truncatula clone mth2-23j1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003606840.10.0B3 DNA-binding domain protein
TrEMBLG7JEX90.0G7JEX9_MEDTR; B3 DNA-binding domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14239914
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06220.11e-12B3 family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]